PDB entry 3b84

View 3b84 on RCSB PDB site
Description: Crystal structure of the human BTB domain of the Krueppel related Zinc Finger Protein 3 (HKR3)
Class: transcription
Keywords: BTB, Krueppel related zinc finger protein 3, HKR3, ZBTB48, zinc finger, oncogene, Structural Genomics Consortium, SGC, Activator, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc-finger
Deposited on 2007-10-31, released 2007-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger and BTB domain-containing protein 48
    Species: Homo sapiens [TaxId:9606]
    Gene: ZBTB48, HKR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10074 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d3b84a1, d3b84a2
  • Heterogens: UNK, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b84A (A:)
    smsfvqhsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqslygdgsgg
    svvlpagfaeifgllldffytghlaltsgnrdqvllaarelrvpeavelcqsfkpktsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b84A (A:)
    msfvqhsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqslygdgsggs
    vvlpagfaeifgllldffytghlaltsgnrdqvllaarelrvpeavelcqsfk