PDB entry 3b7v

View 3b7v on RCSB PDB site
Description: HIV-1 protease complexed with gem-diol-amine tetrahedral intermediate NLLTQI
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 2007-10-31, released 2007-12-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.155
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.02: d3b7va_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.02: d3b7vb_
  • Chain 'C':
    Compound: peptide
    Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • PDB 3B7V (0-5)
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b7vA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b7vB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'C':
    No sequence available.