PDB entry 3b7v
View 3b7v on RCSB PDB site
Description: HIV-1 protease complexed with gem-diol-amine tetrahedral intermediate NLLTQI
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on
2007-10-31, released
2007-12-18
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.155
AEROSPACI score: 0.68
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.02: d3b7va_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.02: d3b7vb_ - Chain 'C':
Compound: peptide
Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Heterogens: NA, CL, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3b7vA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3b7vB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'C':
No sequence available.