PDB entry 3b35

View 3b35 on RCSB PDB site
Description: Crystal structure of the M180A mutant of the aminopeptidase from Vibrio proteolyticus
Class: hydrolase
Keywords: alpha beta, Aminopeptidase, Hydrolase, Metal-binding, Protease, Secreted, Zinc, Zymogen
Deposited on 2007-10-19, released 2007-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.15
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial leucyl aminopeptidase
    Species: Vibrio proteolyticus [TaxId:671]
    Gene: AAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01693 (0-290)
      • engineered (179)
    Domains in SCOPe 2.08: d3b35a_
  • Heterogens: ZN, NA, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b35A (A:)
    mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
    pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
    giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqlda
    tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
    ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg