SCOPe 2.05: Structural Classification of Proteins

PDB entry 3axm

View 3axm on RCSB PDB site
Description: Structure of rice Rubisco in complex with 6PG
Class: Lyase
Keywords: alpha/beta barrel, photosynthetic carbon reduction, Lyase
Deposited on 2011-04-11, released 2012-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.171
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axma1, d3axma2
Chain 'B':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axmb1, d3axmb2
Chain 'C':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axmc1, d3axmc2
Chain 'D':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axmd1, d3axmd2
Chain 'E':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axme1, d3axme2
Chain 'F':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axmf1, d3axmf2
Chain 'G':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axmg1, d3axmg2
Chain 'H':
Compound: ribulose bisphosphate carboxylase large chain
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C512
Domains in SCOPe 2.05: d3axmh1, d3axmh2
Chain 'S':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axms_
Chain 'T':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axmt_
Chain 'U':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axmu_
Chain 'V':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axmv_
Chain 'W':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axmw_
Chain 'X':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axmx_
Chain 'Y':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axmy_
Chain 'Z':
Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
Species: Oryza sativa Japonica Group [TaxId:39947]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0INY7 (1-End)
  - amidation (0)
Domains in SCOPe 2.05: d3axmz_
Heterogens: MG, 6PG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3axmA (A:)
mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds