PDB entry 3ahu

View 3ahu on RCSB PDB site
Description: Crystal structure of YmaH (Hfq) from Bacillus subtilis in complex with an RNA aptamer.
Class: translation/RNA
Keywords: Sm-like motif, Protein-RNA complex, TRANSLATION-RNA complex
Deposited on 2010-04-29, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.259
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17340, hfq, ymaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ahua_
  • Chain 'B':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17340, hfq, ymaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ahub_
  • Chain 'C':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17340, hfq, ymaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ahuc_
  • Chain 'X':
    Compound: 5'-r(*ap*gp*ap*gp*ap*g)-3'
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ahuA (A:)
    gplgsmkpiniqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliy
    khaistfapqknvqlele
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahuA (A:)
    niqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliykhaistfap
    qknvql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ahuB (B:)
    gplgsmkpiniqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliy
    khaistfapqknvqlele
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahuB (B:)
    niqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliykhaistfap
    qknvql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ahuC (C:)
    gplgsmkpiniqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliy
    khaistfapqknvqlele
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahuC (C:)
    niqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliykhaistfap
    qknvql
    

  • Chain 'X':
    No sequence available.