PDB entry 2zeq

View 2zeq on RCSB PDB site
Description: Crystal structure of ubiquitin-like domain of murine Parkin
Class: ligase
Keywords: Parkin, ubiquitin-like domain, Alternative splicing, Cell junction, Cell projection, Cytoplasm, Endoplasmic reticulum, Ligase, Membrane, Metal-binding, Nucleus, Postsynaptic cell membrane, S-nitrosylation, Synapse, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on 2007-12-14, released 2008-08-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.195
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase parkin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WVS6 (2-77)
    • expression tag (0-1)
  Domains in SCOPe 2.01: d2zeqa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zeqA (A:)
  mgmivfvrfnssygfpvevdsdtsilqlkevvakrqgvpadqlrvifagkelpnhltvqn
  cdleqqsivhivqrprrr