PDB entry 2ywz

View 2ywz on RCSB PDB site
Description: Structure of new antigen receptor variable domain from sharks
Class: immune system
Keywords: ig vnar, 1-a-11, immune system
Deposited on 2007-04-23, released 2007-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: new antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ywza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ywzA (A:)
    awvdqtprtitketgesltikcvlkdhscglssttwyrtqlgstnektisiggrydetvd
    kgsksfslrisdlrvedsgtykcqadyspscysypslesavegagtvltvk