PDB entry 2ywx

View 2ywx on RCSB PDB site
Description: Crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from Methanocaldococcus jannaschii
Class: Lyase
Keywords: Rossmann fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Lyase
Deposited on 2007-04-23, released 2007-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.23
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylaminoimidazole carboxylase catalytic subunit
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ywxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ywxA (A:)
miciimgsesdlkiaekavnilkefgvefevrvasahrtpelveeivknskadvfiaiag
laahlpgvvaslttkpviavpvdakldgldallssvqmppgipvatvgidrgenaailal
eilalkdeniakklieyrekmkkkvyasdekvkemfk