PDB entry 2xyq

View 2xyq on RCSB PDB site
Description: crystal structure of the nsp16 nsp10 sars coronavirus complex
Class: transferase/viral protein
Keywords: transferase-viral protein complex, rossman fold
Deposited on 2010-11-18, released 2011-10-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21387
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative 2'-o-methyl transferase
  Species: SARS coronavirus [TaxId:227859]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6X7 (0-289)
• Chain 'B':
  Compound: non-structural protein 10
  Species: SARS coronavirus [TaxId:227859]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6X7 (0-121)
  Domains in SCOPe 2.02: d2xyqb_
• Heterogens: CL, SAH, NA, MG, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xyqB (B:)
  nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg
  gascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs
  cd