PDB entry 2x44

View 2x44 on RCSB PDB site
Description: structure of a strand-swapped dimeric form of ctla-4
Class: immune system
Keywords: immune system, amyloidogenic, systemic lupus erythematosus, immunoglobulin domain, membrane, glycoprotein, transmembrane
Deposited on 2010-01-28, released 2010-04-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19385
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cytotoxic t-lymphocyte protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X44
    • Uniprot P16410 (1-End)
    Domains in SCOPe 2.05: d2x44d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x44D (D:)
    mkamhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgne
    ltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidp
    epspdsdlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x44D (D:)
    mkamhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgne
    ltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidp
    e