PDB entry 2wyq

View 2wyq on RCSB PDB site
Description: the crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Class: DNA binding protein
Keywords: DNA binding protein, DNA excision repair, proteasomal degradation, polyubiquitin
Deposited on 2009-11-19, released 2010-11-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.126
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uv excision repair protein rad23 homolog a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54725 (3-End)
  Domains in SCOPe 2.02: d2wyqa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2wyqA (A:)
  gipmavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsd
  dvpirdyrideknfvvvmvtktkag
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wyqA (A:)
  mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
  irdyrideknfvvvmvt