PDB entry 2wwx

View 2wwx on RCSB PDB site
Description: Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex
Class: protein transport
Keywords: golgi apparatus, protein transport, er-golgi transport, endoplasmic reticulum, prenylation, lipoprotein, nucleotide-binding
Deposited on 2009-10-30, released 2009-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rab-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62820
      • engineered mutation (120)
    Domains in SCOPe 2.06: d2wwxa_
  • Chain 'B':
    Compound: drra
    Species: LEGIONELLA PNEUMOPHILA [TaxId:446]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wwxA (A:)
    mnpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklq
    iwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvg
    ikcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrmgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wwxA (A:)
    ydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwdt
    agqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgikcd
    lttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrmg
    

  • Chain 'B':
    No sequence available.