PDB entry 2wnd

View 2wnd on RCSB PDB site
Description: structure of an s100a7 triple mutant
Class: metal binding protein
Keywords: metal binding protein, disulfide bond, metal-binding, s100a7, ef hand, secreted
Deposited on 2009-07-08, released 2009-11-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21745
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31151 (0-95)
      • see remark 999 (26)
      • engineered mutation (55)
      • engineered mutation (77)
      • engineered mutation (87)
    Domains in SCOPe 2.05: d2wnda_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wndA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnylagvfek
kdknedkkidfseflslmgdiatdyhkkshgaapcs