PDB entry 2wf9

View 2wf9 on RCSB PDB site
Description: structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate, and beryllium trifluoride, crystal form 2
Class: isomerase
Keywords: ground state analogue, transition state analogue, isomerase, phosphotransferase, haloacid dehalogenase superfamily
Deposited on 2009-04-03, released 2010-05-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.185
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-phosphoglucomutase
  Species: LACTOCOCCUS LACTIS [TaxId:1358]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P71447 (0-220)
    • conflict (124)
    • conflict (205)
  Domains in SCOPe 2.01: d2wf9a_
• Heterogens: MG, G6P, BG6, BEF, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2wf9A (A:)
  mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
  dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
  fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
  sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk