PDB entry 2v89

View 2v89 on RCSB PDB site
Description: Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution
Class: protein binding
Keywords: v(d)j recombination, covalent modifications, rag, histone, nucleus, nuclease, hydrolase, phd finger, DNA-binding, recombinase, endonuclease, trimethyl lysine, DNA recombination, protein binding
Deposited on 2007-08-03, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vdj recombination-activating protein 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21784
    • expression tag (4-7)
  Domains in SCOPe 2.08: d2v89a2, d2v89a3
• Chain 'B':
  Compound: vdj recombination-activating protein 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21784 (8-81)
  Domains in SCOPe 2.08: d2v89b_
• Chain 'D':
  Compound: histone h3
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TEC6
    • conflict (7)
    • conflict (9)
• Chain 'E':
  Compound: histone h3
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TEC6 (0-9)
    • conflict (7)
    • conflict (9)
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2v89A (A:)
  gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
  lihlsegsnkyycnehvqiara
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2v89A (A:)
  spefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihl
  segsnkyycnehvqiara
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2v89B (B:)
  gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
  lihlsegsnkyycnehvqiara
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2v89B (B:)
  gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
  nkyycnehvqiara
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.