PDB entry 2v33

View 2v33 on RCSB PDB site
Description: high resolution crystal structure of domain III of e1 fusion glycoprotein of semliki forest virus
Class: viral protein
Keywords: glycoprotein, transmembrane, viral protein
Deposited on 2007-06-11, released 2008-07-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.199
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: e1 envelope glycoprotein
  Species: SEMLIKI FOREST VIRUS [TaxId:11033]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03315 (0-90)
  Domains in SCOPe 2.02: d2v33a_
• Chain 'B':
  Compound: e1 envelope glycoprotein
  Species: SEMLIKI FOREST VIRUS [TaxId:11033]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03315 (0-90)
  Domains in SCOPe 2.02: d2v33b_
• Heterogens: NO3, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v33A (A:)
  eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
  vtlhfstasaspsfvvslcsaratcsascep
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v33B (B:)
  eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
  vtlhfstasaspsfvvslcsaratcsascep