PDB entry 2v1w

View 2v1w on RCSB PDB site
Description: crystal structure of human lim protein ril (pdlim4) pdz domain bound to the c-terminal peptide of human alpha-actinin-1
Class: structural protein
Keywords: actin, stress, fibre dynamics, cytoskeleton, lim domain, metal-binding, phosphorylation, structural protein
Deposited on 2007-05-30, released 2007-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pdz and lim domain protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V1W (86-89)
    • Uniprot P50479 (1-85)
    Domains in SCOPe 2.05: d2v1wa_
  • Chain 'B':
    Compound: pdz and lim domain protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V1W (86-89)
    • Uniprot P50479 (1-85)
    Domains in SCOPe 2.05: d2v1wb_
  • Heterogens: EDO, MG, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v1wA (A:)
    smphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestel
    mthleaqnrikgchdhltlsvsrpegesdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v1wA (A:)
    mphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestelm
    thleaqnrikgchdhltlsvsrpegesdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v1wB (B:)
    smphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestel
    mthleaqnrikgchdhltlsvsrpegesdl