PDB entry 2rpn

View 2rpn on RCSB PDB site
Description: A crucial role for high intrinsic specificity in the function of yeast SH3 domains
Class: structural protein
Keywords: SH3 domain, extended peptide, 3-10 helix, Acetylation, Actin-binding, Cytoplasm, Cytoskeleton, Phosphoprotein, STRUCTURAL PROTEIN
Deposited on 2008-06-12, released 2009-06-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Actin-binding protein
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15891 (1-58)
    • expression tag (0)
  Domains in SCOPe 2.05: d2rpna_
• Chain 'B':
  Compound: Actin-regulating kinase 1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53974 (1-17)
    • expression tag (0)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rpnA (A:)
  apwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn
  

  
  
• Chain 'B':
  No sequence available.