PDB entry 2rht

View 2rht on RCSB PDB site
Description: Crystal Structure of the S112A mutant of a C-C hydrolase, BphD from Burkholderia xenovorans LB400, in complex with 3-Cl HOPDA
Class: hydrolase
Keywords: HYDROLASE, C-C bond hydrolase, Aromatic hydrocarbons catabolism
Deposited on 2007-10-09, released 2007-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.154
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47229 (0-282)
      • engineered (108)
    Domains in SCOPe 2.06: d2rhta_
  • Heterogens: NA, C1E, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rhtA (A:)
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnamggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcghwaqwehadefnrlvidflrha