PDB entry 2rey

View 2rey on RCSB PDB site
Description: Crystal structure of the PDZ domain of human dishevelled 2 (homologous to Drosophila dsh)
Class: gene regulation
Keywords: PDZ, bound peptide, peptide binding site, Structural Genomics, Structural Genomics Consortium, SGC, Developmental protein, Phosphorylation, Wnt signaling pathway, GENE REGULATION
Deposited on 2007-09-27, released 2007-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.212
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Segment polarity protein dishevelled homolog DVL-2
    Species: Homo sapiens [TaxId:9606]
    Gene: dvl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14641 (Start-95)
      • expression tag (96-99)
    Domains in SCOPe 2.01: d2reya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2reyA (A:)
    smslniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
    vndmnfenmsnddavrvlrdivhkpgpivltvakcwetsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2reyA (A:)
    lniitvtlnmeynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnfenm
    snddavrvlrdivhkpgpivltvakcwetsv