PDB entry 2rb6

View 2rb6 on RCSB PDB site
Description: X-Ray structure of the protein Q8EI81. Northeast Structural Genomics Consortium target SoR78A
Class: structural genomics, unknown function
Keywords: NESG, Q8EI81_SHEON, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2007-09-18, released 2007-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_0963
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EI81 (1-52)
      • expression tag (53-57)
    Domains in SCOPe 2.01: d2rb6a1
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_0963
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EI81 (1-52)
      • expression tag (53-56)
    Domains in SCOPe 2.01: d2rb6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2rb6A (A:)
mssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiierlehhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >2rb6A (A:)
ssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiierlehhh

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2rb6B (B:)
mssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiierlehhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >2rb6B (B:)
ssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiierlehh