PDB entry 2r8p

View 2r8p on RCSB PDB site
Description: Transketolase from E. coli in complex with substrate D-fructose-6-phosphate
Class: transferase
Keywords: reaction intermediate, Calcium, Metal-binding, Thiamine pyrophosphate, Transferase
Deposited on 2007-09-11, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transketolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: tktA, tkt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8pa1, d2r8pa2, d2r8pa3
  • Chain 'B':
    Compound: Transketolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: tktA, tkt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • expression tag (663-666)
    Domains in SCOPe 2.07: d2r8pb1, d2r8pb2, d2r8pb3, d2r8pb4
  • Heterogens: CA, T6F, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r8pA (A:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8pA (A:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    ll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r8pB (B:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8pB (B:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llhhhh