PDB entry 2r1c
View 2r1c on RCSB PDB site
Description: Coordinates of the thermus thermophilus ribosome binding factor A (RbfA) homology model as fitted into the CRYO-EM map of a 30S-RBFA complex
Class: RNA binding protein
Keywords: helix-kink-helix, KH domain, rRNA processing, RNA BINDING PROTEIN
Deposited on
2007-08-22, released
2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: EM
Resolution: 12.5 Å
R-factor: N/A
AEROSPACI score: -0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribosome-binding factor a
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0907
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2r1ca1
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2r1cA (A:)
maygkahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalr
alsraerrlvaalarrvrmrrlprleflpwraspa
Sequence, based on observed residues (ATOM records): (download)
>2r1cA (A:)
kahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalralsr
aerrlvaalarrvrmrrlprleflpwraspa