PDB entry 2r1c

View 2r1c on RCSB PDB site
Description: Coordinates of the thermus thermophilus ribosome binding factor A (RbfA) homology model as fitted into the CRYO-EM map of a 30S-RBFA complex
Class: RNA binding protein
Keywords: helix-kink-helix, KH domain, rRNA processing, RNA BINDING PROTEIN
Deposited on 2007-08-22, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: EM
Resolution: 12.5 Å
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome-binding factor a
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0907
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r1ca1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2r1cA (A:)
maygkahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalr
alsraerrlvaalarrvrmrrlprleflpwraspa

    Sequence, based on observed residues (ATOM records): (download) 
    >2r1cA (A:)
kahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalralsr
aerrlvaalarrvrmrrlprleflpwraspa