PDB entry 2r17

View 2r17 on RCSB PDB site
Description: Functional architecture of the retromer cargo-recognition complex
Class: protein transport
Keywords: Protein Transport, Membrane, Phosphorylation
Deposited on 2007-08-22, released 2007-10-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: Homo sapiens [TaxId:9606]
    Gene: Vps29
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBQ0 (1-182)
      • initiating methionine (0)
    Domains in SCOPe 2.02: d2r17a_
  • Chain 'B':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: Homo sapiens [TaxId:9606]
    Gene: Vps29
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBQ0 (1-182)
      • initiating methionine (0)
    Domains in SCOPe 2.02: d2r17b_
  • Chain 'C':
    Compound: Vacuolar protein sorting-associated protein 35
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS35, MEM3
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Vacuolar protein sorting-associated protein 35
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS35, MEM3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2r17A (A:)
mmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhiv
rgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkf
eafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkveriey
kkp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2r17B (B:)
mmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhiv
rgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkf
eafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkveriey
kkp

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.