PDB entry 2qyp

View 2qyp on RCSB PDB site
Description: Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation
Class: lipid binding protein
Keywords: saposin, activator protein, sap, Alternative splicing, Disease mutation, Gaucher disease, Glycoprotein, GM2-gangliosidosis, Lipid metabolism, Lysosome, Metachromatic leukodystrophy, Sphingolipid metabolism, LIPID BINDING PROTEIN
Deposited on 2007-08-15, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.232
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proactivator polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAP, GLBA, SAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qypa_
  • Chain 'B':
    Compound: Proactivator polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAP, GLBA, SAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07602 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d2qypb2, d2qypb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2qypA (A:)
ayvsdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygss
ilsilleevspelvcsmlhlcsgtrhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2qypA (A:)
sdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssils
illeevspelvcsmlhlc

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2qypB (B:)
ayvsdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygss
ilsilleevspelvcsmlhlcsgtrhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2qypB (B:)
ayvsdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygss
ilsilleevspelvcsmlhlc