PDB entry 2qhr

View 2qhr on RCSB PDB site
Description: Crystal structure of the 13F6-1-2 Fab fragment bound to its Ebola virus glycoprotein peptide epitope.
Class: Immune system/viral protein
Keywords: immunologlobulin fold, antibody-peptide complex, Immune system/viral protein COMPLEX
Deposited on 2007-07-02, released 2008-01-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 13F6-1-2 Fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QHR (0-221)
    Domains in SCOPe 2.05: d2qhrh1
  • Chain 'L':
    Compound: 13F6-1-2 Fab fragment V lambda x light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Envelope glycoprotein peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2QHR (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qhrH (H:)
evqvvesggglvkpggslklscaasgfafssydmswvrqtpekrlewvayisrgggytyy
pdtvkgrftisrdnakntlylqmsslksedtamyycsrhiyygsshyyamdywgqgtsvt
vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

  • Chain 'L':
    No sequence available.

  • Chain 'P':
    No sequence available.