PDB entry 2pym

View 2pym on RCSB PDB site
Description: HIV-1 PR mutant in complex with nelfinavir
Class: hydrolase
Keywords: resistance; nelfinavir, HYDROLASE
Deposited on 2007-05-16, released 2008-02-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (29)
      • engineered (40)
      • engineered (87)
    Domains in SCOPe 2.02: d2pyma_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (29)
      • engineered (40)
      • engineered (87)
    Domains in SCOPe 2.02: d2pymb_
  • Heterogens: 1UN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pymA (A:)
    pqitlwqrplvtikiggqlkealldtgadntvleemslpgawkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrdlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pymB (B:)
    pqitlwqrplvtikiggqlkealldtgadntvleemslpgawkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrdlltqigctlnf