PDB entry 2pvf

View 2pvf on RCSB PDB site
Description: Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase Domain in Complex with ATP Analog and Substrate Peptide
Class: transferase
Keywords: Kinase Domain Fold Consisting of N- and C-lobes, TRANSFERASE
Deposited on 2007-05-09, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.251
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (46)
    Domains in SCOPe 2.07: d2pvfa_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pvfA (A:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttneeyldlsqpleq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvfA (A:)
    elpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpvtvavkmlkddatekdls
    dlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmeysyq
    mtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyy
    kkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllk
    eghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltltt
    

  • Chain 'B':
    No sequence available.