PDB entry 2plp

View 2plp on RCSB PDB site
Description: Ultra high resolution backbone conformation of protein GB1 from residual dipolar couplings alone
Class: immune system/protein binding
Keywords: residual dipolar couplings; perdeuteration; NMR; ultra-high resolution; proton-proton couplings; rdc; hydrogen bonds, IMMUNE SYSTEM/PROTEIN BINDING COMPLEX
Deposited on 2007-04-20, released 2007-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2plpa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2plpA (A:)
    tyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt