PDB entry 2pe8

View 2pe8 on RCSB PDB site
Description: Crystal structure of the UHM domain of human SPF45 (free form)
Class: protein binding
Keywords: rrm, protein binding
Deposited on 2007-04-02, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 45
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM17, SPF45
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96I25 (4-104)
      • cloning artifact (1-3)
    Domains in SCOPe 2.07: d2pe8a1, d2pe8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pe8A (A:)
    gamgkcptkvvllrnmvgagevdedlevetkeecekygkvgkcvifeipgapddeavrif
    lefervesaikavvdlngryfggrvvkacfynldkfrvldlaeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pe8A (A:)
    amgkcptkvvllrnmvgagevlevetkeecekygkvgkcvifeipgapddeavriflefe
    rvesaikavvdlngryfggrvvkacfynldkfrvldlaeqv