PDB entry 2p91

View 2p91 on RCSB PDB site
Description: Crystal structure of Enoyl-[acyl-carrier-protein] reductase (NADH) from Aquifex aeolicus VF5
Class: oxidoreductase
Keywords: NADH-dependent enoyl-ACP reductase, aq_1552, fabI, Aquifex aeolicus VF5, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, RSGI, OXIDOREDUCTASE
Deposited on 2007-03-23, released 2007-04-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
  Species: Aquifex aeolicus [TaxId:224324]
  Gene: fabI, aq_1552
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67505
• Chain 'B':
  Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
  Species: Aquifex aeolicus [TaxId:224324]
  Gene: fabI, aq_1552
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67505
• Chain 'C':
  Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
  Species: Aquifex aeolicus [TaxId:224324]
  Gene: fabI, aq_1552
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67505
• Chain 'D':
  Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
  Species: Aquifex aeolicus [TaxId:224324]
  Gene: fabI, aq_1552
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67505
  Domains in SCOPe 2.01: d2p91d_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2p91D (D:)
  mlrklskfsnkgevfmgllegkralitgvanersiaygiaksfhregaqlaftyatpkle
  krvreiakgfgsdlvvkcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvi
  dtsregfkiamdisvyslialtrellplmegrngaivtlsyygaekvvphynvmgiakaa
  lestvrylaydiakhghrinaisagpvktlaaysitgfhllmehttkvnpfgkpitiedv
  gdtavflcsdwaraitgevvhvdngyhimgvfgreeeikkevygd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2p91D (D:)
  gllegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakgfgsdlvv
  kcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvy
  slialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhg
  hrinaisagpvkfgkpitiedvgdtavflcsdwaraitgevvhvdngyhimgv