PDB entry 2p5l

View 2p5l on RCSB PDB site
Description: Crystal structure of a dimer of N-terminal domains of AhrC in complex with an 18bp DNA operator site
Class: transcription repressor
Keywords: DNA-binding domain, winged helix-turn-helix, ARG box, protein-DNA complex, transcription repressor
Deposited on 2007-03-15, released 2008-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.208
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(*dcp*dap*dtp*dgp*dap*dap*dtp*dap*dap*dap*dap*dap*dtp*dtp*dcp*dap*dap*dg)-3')
  Species: synthetic, synthetic
  
• Chain 'B':
  Compound: DNA (5'-d(*dcp*dtp*dtp*dgp*dap*dap*dtp*dtp*dtp*dtp*dtp*dap*dtp*dtp*dcp*dap*dtp*dg)-3')
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: Arginine repressor
  Species: Bacillus subtilis [TaxId:1423]
  Gene: argR, ahrC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17893 (Start-63)
  Domains in SCOPe 2.05: d2p5lc1
• Chain 'D':
  Compound: Arginine repressor
  Species: Bacillus subtilis [TaxId:1423]
  Gene: argR, ahrC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17893 (0-63)
  Domains in SCOPe 2.05: d2p5ld1
• Chain 'E':
  Compound: DNA (5'-d(*dcp*dap*dtp*dgp*dap*dap*dtp*dap*dap*dap*dap*dap*dtp*dtp*dcp*dap*dap*dg)-3')
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: DNA (5'-d(*dcp*dtp*dtp*dgp*dap*dap*dtp*dtp*dtp*dtp*dtp*dap*dtp*dtp*dcp*dap*dtp*dg)-3')
  Species: synthetic, synthetic
  
• Chain 'G':
  Compound: Arginine repressor
  Species: Bacillus subtilis [TaxId:1423]
  Gene: argR, ahrC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17893 (Start-63)
  Domains in SCOPe 2.05: d2p5lg1
• Chain 'H':
  Compound: Arginine repressor
  Species: Bacillus subtilis [TaxId:1423]
  Gene: argR, ahrC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17893 (0-63)
  Domains in SCOPe 2.05: d2p5lh1
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2p5lC (C:)
  mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
  kysl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2p5lC (C:)
  nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
  ysl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p5lD (D:)
  mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
  kysl
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence, based on SEQRES records: (download)
  

  >2p5lG (G:)
  mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
  kysl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2p5lG (G:)
  nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
  ysl
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p5lH (H:)
  mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
  kysl