PDB entry 2p4p

View 2p4p on RCSB PDB site
Description: Crystal structure of a CorC_HlyC domain from Haemophilus ducreyi
Class: structural genomics, unknown function
Keywords: Haemophilus ducreyi, CorC_HlyC, PFAM: PF03471, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-03-12, released 2007-05-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HD1797
    Species: Haemophilus ducreyi [TaxId:233412]
    Gene: TlyC, HD_1797
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VKS4 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (22)
      • modified residue (43-44)
      • modified residue (46)
      • modified residue (49)
      • modified residue (52-53)
      • modified residue (61)
      • modified residue (63)
      • modified residue (78)
      • modified residue (83)
    Domains in SCOPe 2.02: d2p4pa1
  • Chain 'B':
    Compound: Hypothetical protein HD1797
    Species: Haemophilus ducreyi [TaxId:233412]
    Gene: TlyC, HD_1797
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VKS4
      • modified residue (22)
      • modified residue (43-44)
      • modified residue (46)
      • modified residue (49)
      • modified residue (52-53)
      • modified residue (61)
      • modified residue (63)
      • modified residue (78)
      • modified residue (83)
    Domains in SCOPe 2.02: d2p4pb_
  • Heterogens: CA, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2p4pA (A:)
snamrrnedswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvly
dkykfeiidtenfridqlmvsfrkdv

    Sequence, based on observed residues (ATOM records): (download) 
    >2p4pA (A:)
namrrnedswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvlyd
kykfeiidtenfridqlmvsfrkd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2p4pB (B:)
snamrrnedswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvly
dkykfeiidtenfridqlmvsfrkdv

    Sequence, based on observed residues (ATOM records): (download) 
    >2p4pB (B:)
dswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvlydkykfeii
dtenfridqlmvsfrkd