PDB entry 2p3d

View 2p3d on RCSB PDB site
Description: Crystal Structure of the multi-drug resistant mutant subtype F HIV protease complexed with TL-3 inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: multi-drug resistant mutant subtype F HIV protease, TL-3 inhibitor, non-B HIV protease, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2007-03-08, released 2007-04-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SRY5 (0-98)
  Domains in SCOPe 2.01: d2p3da_
• Chain 'B':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SRY5 (0-98)
  Domains in SCOPe 2.01: d2p3db_
• Heterogens: 3TL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p3dA (A:)
  pqitlwkrpivtikvegqlrealldtgaddtvledinlsgkwkpkiiggirgfvkvkqye
  dilieicghravgavlvgptpaniigrnmltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p3dB (B:)
  pqitlwkrpivtikvegqlrealldtgaddtvledinlsgkwkpkiiggirgfvkvkqye
  dilieicghravgavlvgptpaniigrnmltqigctlnf