PDB entry 2p3c

View 2p3c on RCSB PDB site
Description: Crystal Structure of the subtype F wild type HIV protease complexed with TL-3 inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: wild type subtype F HIV protease, TL-3 inhibitor, non-B HIV protease, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2007-03-08, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6Q004 (0-98)
    • engineered (6)
    • variant (36)
  Domains in SCOPe 2.08: d2p3ca_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6Q004 (0-98)
    • engineered (6)
    • variant (36)
  Domains in SCOPe 2.08: d2p3cb_
• Heterogens: 3TL, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p3cA (A:)
  pqitlwkrplvtikvggqlkealldtgaddtvledialpgkwkpkmiggiggfikvkqye
  nvsleicghkaigtvlvgptpvniigrnmltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p3cB (B:)
  pqitlwkrplvtikvggqlkealldtgaddtvledialpgkwkpkmiggiggfikvkqye
  nvsleicghkaigtvlvgptpvniigrnmltqigctlnf