PDB entry 2onk

View 2onk on RCSB PDB site
Description: ABC transporter ModBC in complex with its binding protein ModA
Class: membrane protein
Keywords: membrane protein
Deposited on 2007-01-24, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.256
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdate/tungstate ABC transporter, ATP-binding protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onka1
  • Chain 'B':
    Compound: Molybdate/tungstate ABC transporter, ATP-binding protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onkb_
  • Chain 'C':
    Compound: Molybdate/tungstate ABC transporter, permease protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onkc1
  • Chain 'D':
    Compound: Molybdate/tungstate ABC transporter, permease protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onkd1
  • Chain 'E':
    Compound: molybdate/tungstate binding protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onke1
  • Chain 'F':
    Compound: Molybdate/tungstate ABC transporter, ATP-binding protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onkf_
  • Chain 'G':
    Compound: Molybdate/tungstate ABC transporter, ATP-binding protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onkg_
  • Chain 'H':
    Compound: Molybdate/tungstate ABC transporter, permease protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onkh1
  • Chain 'I':
    Compound: Molybdate/tungstate ABC transporter, permease protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onki1
  • Chain 'J':
    Compound: molybdate/tungstate binding protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30142 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2onkj2, d2onkj3
  • Heterogens: WO4, PO4, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onkA (A:)
    mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga
    ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll
    drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi
    lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onkB (B:)
    mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga
    ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll
    drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi
    lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2onkC (C:)
    mghhhhhhhhhhssgenlyfqghmrllfsallallssiillfvllpvaatvtlqlfnfde
    flkaasdpavwkvvlttyyaalistliavifgtplayilarksfpgksvvegivdlpvvi
    phtvagiallvvfgssgligsfsplkfvdalpgivvamlfvsvpiyinqakegfasvdvr
    lehvartlgssplrvfftvslplsvrhivagaimswargisefgavvviayypmiaptli
    yerylseglsaampvaailillslavfvalriivgredvsegqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onkC (C:)
    mrllfsallallssiillfvllpvaatvtlqlfnfdeflkaasdpavwkvvlttyyaali
    stliavifgtplayilarksfpgksvvegivdlpvviphtvagiallvvfgssgligsfs
    plkfvdalpgivvamlfvsvpiyinqakegfasvdvrlehvartlgssplrvfftvslpl
    svrhivagaimswargisefgavvviayypmiaptliyerylseglsaampvaailills
    lavfvalriivg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2onkD (D:)
    mghhhhhhhhhhssgenlyfqghmrllfsallallssiillfvllpvaatvtlqlfnfde
    flkaasdpavwkvvlttyyaalistliavifgtplayilarksfpgksvvegivdlpvvi
    phtvagiallvvfgssgligsfsplkfvdalpgivvamlfvsvpiyinqakegfasvdvr
    lehvartlgssplrvfftvslplsvrhivagaimswargisefgavvviayypmiaptli
    yerylseglsaampvaailillslavfvalriivgredvsegqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onkD (D:)
    mrllfsallallssiillfvllpvaatvtlqlfnfdeflkaasdpavwkvvlttyyaali
    stliavifgtplayilarksfpgksvvegivdlpvviphtvagiallvvfgssgligsfs
    plkfvdalpgivvamlfvsvpiyinqakegfasvdvrlehvartlgssplrvfftvslpl
    svrhivagaimswargisefgavvviayypmiaptliyerylseglsaampvaailills
    lavfvalriivg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2onkE (E:)
    ghmnvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadvia
    tadytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfs
    npnddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsseriein
    kskimirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskv
    kvvlangkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppra
    dtavpslkamvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onkE (E:)
    nvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadviatad
    ytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfsnpn
    ddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsserieinksk
    imirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskvkvv
    langkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppradta
    vpslkamvevs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onkF (F:)
    mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga
    ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll
    drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi
    lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onkG (G:)
    mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga
    ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll
    drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi
    lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2onkH (H:)
    mghhhhhhhhhhssgenlyfqghmrllfsallallssiillfvllpvaatvtlqlfnfde
    flkaasdpavwkvvlttyyaalistliavifgtplayilarksfpgksvvegivdlpvvi
    phtvagiallvvfgssgligsfsplkfvdalpgivvamlfvsvpiyinqakegfasvdvr
    lehvartlgssplrvfftvslplsvrhivagaimswargisefgavvviayypmiaptli
    yerylseglsaampvaailillslavfvalriivgredvsegqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onkH (H:)
    mrllfsallallssiillfvllpvaatvtlqlfnfdeflkaasdpavwkvvlttyyaali
    stliavifgtplayilarksfpgksvvegivdlpvviphtvagiallvvfgssgligsfs
    plkfvdalpgivvamlfvsvpiyinqakegfasvdvrlehvartlgssplrvfftvslpl
    svrhivagaimswargisefgavvviayypmiaptliyerylseglsaampvaailills
    lavfvalriivg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2onkI (I:)
    mghhhhhhhhhhssgenlyfqghmrllfsallallssiillfvllpvaatvtlqlfnfde
    flkaasdpavwkvvlttyyaalistliavifgtplayilarksfpgksvvegivdlpvvi
    phtvagiallvvfgssgligsfsplkfvdalpgivvamlfvsvpiyinqakegfasvdvr
    lehvartlgssplrvfftvslplsvrhivagaimswargisefgavvviayypmiaptli
    yerylseglsaampvaailillslavfvalriivgredvsegqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onkI (I:)
    mrllfsallallssiillfvllpvaatvtlqlfnfdeflkaasdpavwkvvlttyyaali
    stliavifgtplayilarksfpgksvvegivdlpvviphtvagiallvvfgssgligsfs
    plkfvdalpgivvamlfvsvpiyinqakegfasvdvrlehvartlgssplrvfftvslpl
    svrhivagaimswargisefgavvviayypmiaptliyerylseglsaampvaailills
    lavfvalriivg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2onkJ (J:)
    ghmnvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadvia
    tadytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfs
    npnddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsseriein
    kskimirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskv
    kvvlangkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppra
    dtavpslkamvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onkJ (J:)
    ghmnvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadvia
    tadytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfs
    npnddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsseriein
    kskimirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskv
    kvvlangkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppra
    dtavpslkam