PDB entry 2oeo

View 2oeo on RCSB PDB site
Description: Cryogenic crystal structure of Staphylococcal Nuclease variant truncated Delta+PHS I92D
Class: hydrolase
Keywords: OB-fold, HYDROLASE
Deposited on 2006-12-30, released 2008-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • see remark 999 (43-44)
      • see remark 999 (57)
      • see remark 999 (76)
      • see remark 999 (83)
      • see remark 999 (94)
      • see remark 999 (103)
      • see remark 999 (109-110)
      • see remark 999 (120-121)
    Domains in SCOPe 2.06: d2oeoa_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2oeoA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkamv
enakkievefdkgqrtdkygrglaydyadgamvnealvrqglaavayvysgnntheqllr
aaeaqakkeklniwsedn

    Sequence, based on observed residues (ATOM records): (download) 
    >2oeoA (A:)
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkamvenakk
ievefdkgqrtdkygrglaydyadgamvnealvrqglaavayvysgnntheqllraaeaq
akkeklniws