PDB entry 2oaw

View 2oaw on RCSB PDB site
Description: Structure of SHH variant of "Bergerac" chimera of spectrin SH3
Class: structural protein
Keywords: SH3 domain, chimera, STRUCTURAL PROTEIN
Deposited on 2006-12-18, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751
      • insertion (41-44)
      • engineered (46)
      • insertion (47-50)
    Domains in SCOPe 2.06: d2oawa_
  • Chain 'B':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751
      • insertion (41-44)
      • engineered (46)
      • insertion (47-50)
    Domains in SCOPe 2.06: d2oawb_
  • Chain 'C':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751
      • insertion (41-44)
      • engineered (46)
      • insertion (47-50)
    Domains in SCOPe 2.06: d2oawc_
  • Chain 'D':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (0-64)
      • insertion (41-44)
      • engineered (46)
      • insertion (47-50)
    Domains in SCOPe 2.06: d2oawd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oawA (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
    vkkld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oawB (B:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
    vkkld
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oawC (C:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
    vkkld
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oawD (D:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
    vkkld