PDB entry 2o85

View 2o85 on RCSB PDB site
Description: S. Aureus thioredoxin P31T mutant
Class: electron transport
Keywords: thioredoxin, oxidoreductase, redox enzyme, ELECTRON TRANSPORT
Deposited on 2006-12-12, released 2007-07-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K6 (Start-106)
      • engineered (33)
    Domains in SCOPe 2.01: d2o85a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2o85A (A:)
gshmaivkvtdadfdskvesgvqlvdfwatwcgtckmiapvleelaadyegkadilkldv
denpstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl

    Sequence, based on observed residues (ATOM records): (download) 
    >2o85A (A:)
aivkvtdadfdskvesgvqlvdfwatwcgtckmiapvleelaadyegkadilkldvdenp
staakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl