PDB entry 2o6q

View 2o6q on RCSB PDB site
Description: Structural diversity of the hagfish Variable Lymphocyte Receptors A29
Class: immune system
Keywords: Leucine-rich repeat protein, LRR, IMMUNE SYSTEM
Deposited on 2006-12-08, released 2006-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Variable lymphocyte receptor A
    Species: Eptatretus burgeri [TaxId:7764]
    Gene: VLRA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2o6qa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2o6qA (A:)
nealckkdggvcscnnnknsvdcsskkltaipsnipadtkkldlqsnklsslpskafhrl
tklrllylndnklqtlpagifkelknletlwvtdnklqalpigvfdqlvnlaelrldrnq
lkslpprvfdsltkltylslgynelqslpkgvfdkltslkelrlynnqlkrvpegafdkl
telktlkldnnqlkrvpegafdsleklkmlqlqenpwdctcngiiymakwlkkkadeglg
gvdtagcekggkavleitekdaasdcvspn