PDB entry 2o49

View 2o49 on RCSB PDB site
Description: Crystal Structure of the N-terminal CUT domain of SATB1 Bound to Matrix Attachment Region DNA
Class: transcription/DNA
Keywords: protein-DNA complex, transcription, TRANSCRIPTION/DNA COMPLEX
Deposited on 2006-12-04, released 2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding protein SATB1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01826 (Start-88)
    • cloning artifact (89)
  Domains in SCOPe 2.08: d2o49a2, d2o49a3
• Chain 'B':
  Compound: DNA (5'-d(*dgp*dcp*dtp*dap*dap*dtp*dap*dtp*dap*dtp*dgp*dc)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*dgp*dcp*dap*dtp*dap*dtp*dap*dtp*dtp*dap*dgp*dc)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2o49A (A:)
  gshmntevsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsll
  vnlramqnflqlpeaerdriyqdererslrkrk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2o49A (A:)
  evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram
  qnflqlpeaerdriyqdererslr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.