PDB entry 2o49
View 2o49 on RCSB PDB site
Description: Crystal Structure of the N-terminal CUT domain of SATB1 Bound to Matrix Attachment Region DNA
Class: transcription/DNA
Keywords: protein-DNA complex, transcription, TRANSCRIPTION/DNA COMPLEX
Deposited on
2006-12-04, released
2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: DNA-binding protein SATB1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2o49a2, d2o49a3 - Chain 'B':
Compound: DNA (5'-d(*dgp*dcp*dtp*dap*dap*dtp*dap*dtp*dap*dtp*dgp*dc)-3')
- Chain 'C':
Compound: DNA (5'-d(*dgp*dcp*dap*dtp*dap*dtp*dap*dtp*dtp*dap*dgp*dc)-3')
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2o49A (A:)
gshmntevsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsll
vnlramqnflqlpeaerdriyqdererslrkrk
Sequence, based on observed residues (ATOM records): (download)
>2o49A (A:)
evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram
qnflqlpeaerdriyqdererslr
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.