PDB entry 2nmu

View 2nmu on RCSB PDB site
Description: Crystal structure of the hypothetical protein from Salmonella typhimurium LT2. Northeast Structural Genomics Consortium target StR127.
Class: DNA binding protein
Keywords: NESG X-Ray Q8ZM67 StR127, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, DNA BINDING PROTEIN
Deposited on 2006-10-23, released 2006-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative DNA-binding protein
  Species: Salmonella typhimurium [TaxId:602]
  Gene: STM3071
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8ZM67 (Start-147)
    • modified residue (102)
    • modified residue (107-108)
    • cloning artifact (148)
  Domains in SCOPe 2.06: d2nmua1, d2nmua2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2nmuA (A:)
  magdpnsmtvshhnastarfyalrllpgqevfsqlhafvqqnqlraawiagctgsltdva
  lryagqeattsltgtfevislngtleltgehlhlavsdpygvmlgghmmpgctvrttlel
  vigelpaltfsrqpcaisgydelhissrlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2nmuA (A:)
  hnastarfyalrllpgqevfsqlhafvqqnqlraawiagctgsltdvalryagqeattsl
  tgtfevislngtleltgehlhlavsdpygvmlgghmmpgctvrttlelvigelpaltfsr
  qpcaisgydelhissrl