PDB entry 2nms

View 2nms on RCSB PDB site
Description: The Crystal Structure of the Extracellular Domain of the Inhibitor Receptor Expressed on Myeloid Cells IREM-1
Class: immune system
Keywords: IG-SUPERFAMILY, IG-V, NKP44-LIKE, MYELOID IG-LIKE RECEPTOR, inhibitory receptor, myelo-monocytic cells, negative regulation of leukocyte, membrane protein, IMMUNE SYSTEM
Deposited on 2006-10-23, released 2006-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CMRF35-like-molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD300LF, CLM1, IGSF13, IREM1, NKIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TDQ1 (4-End)
      • cloning artifact (1-3)
    Domains in SCOPe 2.08: d2nmsa1, d2nmsa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nmsA (A:)
    rgipqitgpttvnglergsltvqcvyrsgwetylkwwcrgaiwrdckilvktsgseqevk
    rdrvsikdnqknrtftvtmedlmktdadtywcgiektgndlgvtvqvtidpapvtqeets
    sspt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nmsA (A:)
    gipqitgpttvnglergsltvqcvyrsgwetylkwwcrgaiwrdckilvktsgseqevkr
    drvsikdnqknrtftvtmedlmktdadtywcgiektgndlgvtvqvtidpap