PDB entry 2nmq

View 2nmq on RCSB PDB site
Description: Simultaneous determination of protein structure and dynamics using rdcs
Class: signaling protein
Keywords: residual dipolar couplings, nmr, simultaneous structure and dynamics, high resolution, SIGNALING PROTEIN
Deposited on 2006-10-23, released 2006-11-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2008-06-03, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G precursor
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2nmqa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nmqA (A:)
    tyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte