PDB entry 2mzz

View 2mzz on RCSB PDB site
Description: NMR structure of APOBEC3G NTD variant, sNTD
Class: Hydrolase, Antiviral protein
Keywords: Vif-binding domain, Hydrolase, Antiviral protein
Deposited on 2015-02-28, released 2015-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apolipoprotein B mRNA-editing enzyme, catalytic polypeptide-like 3G variant
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2MZZ (0-179)
    Domains in SCOPe 2.08: d2mzza_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mzzA (A:)
mdpdtfsynfnnrpilsrrntvwlcyevktkgpsrppldakifrgqvysedkyhpemrfl
slvskwklhrdqeyevtwyiswspctkcardmatflqenthvtltifvarlyyawdpdyq
ealrslaqagatikimnydefqhcwskfvysqgapfqpwdgldehsqalsgrlgeilrhs