PDB entry 2myf

View 2myf on RCSB PDB site
Description: Solution structure of RNA recognition motif of a cyclophilin33-like protein from Plasmodium falciparum
Class: RNA binding protein
Keywords: PfCyp33, RNA recognition motif, RNA BINDING PROTEIN
Deposited on 2015-01-22, released 2016-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RRM containing cyclophilin
  Species: PLASMODIUM FALCIPARUM [TaxId:36329]
  Gene: PF13_0122
  Database cross-references and differences (RAF-indexed):
  • Uniprot C0H5C7 (3-88)
    • expression tag (0-2)
  Domains in SCOPe 2.06: d2myfa1, d2myfa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2myfA (A:)
  gshmsdnnatdilfvggidetidekslydifssfgdirnievplnmttkknrgfafveyv
  evddakhalynmnnfelngkrihvnyskt