PDB entry 2mut

View 2mut on RCSB PDB site
Description: Solution structure of the F231L mutant ERCC1-XPF dimerization region
Class: hydrolase
Keywords: ERCC1-XPF, F231L, Nucleotide Excision Repair, HYDROLASE
Deposited on 2014-09-17, released 2015-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA excision repair protein ERCC-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERCC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07992 (8-85)
      • expression tag (0-7)
      • engineered mutation (19)
      • expression tag (86-95)
    Domains in SCOPe 2.08: d2muta1, d2muta2, d2muta3
  • Chain 'B':
    Compound: DNA repair endonuclease XPF
    Species: Homo sapiens [TaxId:9606]
    Gene: ERCC4, ERCC11, XPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92889 (1-83)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d2mutb1, d2mutb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mutA (A:)
    rirrrynmadllmekleqdlvsrvteclttvksvnktdsqtllttfgsleqliaasredl
    alcpglgpqkarrlfdvlhepflkvpgglehhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mutB (B:)
    mdsetlpesekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaa
    nakqlydfihtsfaevvskgkgkk