PDB entry 2msl

View 2msl on RCSB PDB site
Description: Solution Structure and Chemical Shift Assignments for the Apo form of the Receiver Domain of Nitrogen Regulatory Protein C (NTRC) at 35C
Class: Transcription
Keywords: Transcription
Deposited on 2014-08-04, released 2015-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulation protein nr(I)
    Species: Salmonella typhimurium [TaxId:990282]
    Gene: glnG ntrC STM4005
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2msla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mslA (A:)
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe