PDB entry 2mpu

View 2mpu on RCSB PDB site
Description: Structural and Functional analysis of the Hordeum vulgare L. HvGR-RBP1 protein, a glycine-rich RNA binding protein implicated in the regulation of barley leaf senescence and environmental adaptation
Class: RNA binding protein
Keywords: RNA recognition motif, RRM, RNP1, RNP2, glycine rich protein, nucleic acid binding protein, RNA BINDING PROTEIN
Deposited on 2014-06-02, released 2014-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rbp1
    Species: Hordeum vulgare [TaxId:4513]
    Gene: rbp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mpua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mpuA (A:)
maesdgaeyrcfvgslswntddrgleaafssfgeildakiindretgrsrgfgfvsfsne
qamqdaiegmngkeldgrsivvneaqsrgygg