PDB entry 2mpq

View 2mpq on RCSB PDB site
Description: Solution structure of the sodium channel toxin Hd1a
Class: toxin
Keywords: Spider toxin, Disulfide-rich peptide, Sodium channel, Knottin, Inhibitor cystine knot, toxin
Deposited on 2014-06-01, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hd1a
  Species: Haplopelma doriae [TaxId:1046906]
  Database cross-references and differences (RAF-indexed):
  • PDB 2MPQ (0-35)
  Domains in SCOPe 2.06: d2mpqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mpqA (A:)
  gaclgfgkscnpsndqcckssslacstkhkwckyel